DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt6

DIOPT Version :10

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:XP_321669.4 Gene:Sirt6 / 1281717 VectorBaseID:AGAMI1_004224 Length:354 Species:Anopheles gambiae


Alignment Length:59 Identity:14/59 - (23%)
Similarity:28/59 - (47%) Gaps:13/59 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TLQALGMM--KYWKGKHIILKKLDV----------LDEYEERVKRRGNMPKIDQSCLKW 110
            |..|:|::  |..:|| |:.|:::|          .:::..|||....:.|..:...:|
Mosquito    68 TQHAVGVIVNKRVRGK-ILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQW 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 SIRT1 222..476 CDD:238699
Sirt6XP_321669.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.