DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and cbpA

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_415520.1 Gene:cbpA / 947572 ECOCYCID:EG12193 Length:306 Species:Escherichia coli


Alignment Length:385 Identity:100/385 - (25%)
Similarity:147/385 - (38%) Gaps:121/385 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPD--KNPDAGDKFKEISFAYEVLSDPEKRRIY 63
            |:..:.|.::.|.|....:.||..||:||:::|||  |.|||..:|||::.|:|||||.::|..|
E. coli     1 MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEY 65

  Fly    64 DR---------------YGLKGLQEGAEGFSDA-SEFFAQWFPFDRVSSEGRGRRNGKVVVKVEL 112
            |:               :| .|....||.|.|. |..|.|   ..|.|.:....|...:.::|.:
E. coli    66 DQMWQHRNDPQFNRQFHHG-DGQSFNAEDFDDIFSSIFGQ---HARQSRQRPATRGHDIEIEVAV 126

  Fly   113 TLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTC 177
            .|||. :...|:.:.||                                            .|..
E. coli   127 FLEET-LTEHKRTISYN--------------------------------------------LPVY 146

  Fly   178 DGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPF-ANEGHQMR----------GG 231
            :                ..|.:||::.:.|.|        |:|. ...|.::|          ||
E. coli   147 N----------------AFGMIEQEIPKTLNV--------KIPAGVGNGQRIRLKGQGTPGENGG 187

  Fly   232 EFGDLIVVISQMEHPIFQRRHANLYMRDLEINIT----EALCGYSHCFKHLDGRNVCLRTYPGEV 292
            ..|||.:||....||:|     ::..:||||.:.    ||..|.......|. .::.|...||. 
E. coli   188 PNGDLWLVIHIAPHPLF-----DIVGQDLEIVVPVSPWEAALGAKVTVPTLK-ESILLTIPPGS- 245

  Fly   293 LQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFP----DNDFATAPQLAMLEDLLPPRQ 348
             |..|...|:|.|: |..|.|  ||||...|:..|    :|..|...|||..:....||:
E. coli   246 -QAGQRLRVKGKGL-VSKKQT--GDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 100/385 (26%)
DnaJ 5..64 CDD:278647 26/60 (43%)
DnaJ_C 106..329 CDD:199909 52/241 (22%)
DnaJ_zf 134..197 CDD:199908 1/62 (2%)
cbpANP_415520.1 PRK10266 1..306 CDD:182347 100/385 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.