DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnaJ

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_414556.1 Gene:dnaJ / 944753 ECOCYCID:EG10240 Length:376 Species:Escherichia coli


Alignment Length:402 Identity:129/402 - (32%)
Similarity:187/402 - (46%) Gaps:50/402 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRI 62
            |...:.|::|.|:..|.:.||:|.|::||.::|||:|   .:|..|||||..|||||:|.:||..
E. coli     1 MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 65

  Fly    63 YDRYGLKGLQEGA------EGFSDASEFFAQWFPFDRVSSEGRGR----RNGKVVVKVELTLEEI 117
            ||:||....::|.      .|.:|.|:.|..  .|..:...||||    |...:...:||||||.
E. coli    66 YDQYGHAAFEQGGMGGGGFGGGADFSDIFGD--VFGDIFGGGRGRQRAARGADLRYNMELTLEEA 128

  Fly   118 YVGGMKKKVEYNRQKLCSKCNGDGG-PKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRG 181
             |.|:.|::.....:.|..|:|.|. |....::|.||.|:|:..  ...|......|||.|.|||
E. coli   129 -VRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQ--MRQGFFAVQQTCPHCQGRG 190

  Fly   182 FTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQ-MRGGEFGDLIVVISQMEH 245
            ..|:|  .|:.|.|.|.||:.....:.:..|.....::..|.||.. ..|...|||.|.:...:|
E. coli   191 TLIKD--PCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQH 253

  Fly   246 PIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFN 310
            |||:|...|||. ::.||...|..|.......|||| |.|:. |||. |..::..:||.|:... 
E. coli   254 PIFEREGNNLYC-EVPINFAMAALGGEIEVPTLDGR-VKLKV-PGET-QTGKLFRMRGKGVKSV- 313

  Fly   311 KATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQMTDYKP-----QPRQ 370
            :....|||..:..|:.|..              |..||..::    :|:|.:...|     .||.
E. coli   314 RGGAQGDLLCRVVVETPVG--------------LNERQKQLL----QELQESFGGPTGEHNSPRS 360

  Fly   371 QEDEDGQSSHFE 382
            :...||....|:
E. coli   361 KSFFDGVKKFFD 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 123/376 (33%)
DnaJ 5..64 CDD:278647 28/61 (46%)
DnaJ_C 106..329 CDD:199909 74/224 (33%)
DnaJ_zf 134..197 CDD:199908 23/63 (37%)
dnaJNP_414556.1 PRK10767 1..372 CDD:236757 128/400 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.