DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and DNAJA3

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_005138.3 Gene:DNAJA3 / 9093 HGNCID:11808 Length:480 Species:Homo sapiens


Alignment Length:421 Identity:126/421 - (29%)
Similarity:182/421 - (43%) Gaps:97/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68
            |.:|.|..:|:.:||||.|.:|||::|||.|   |.|.:||.:::.|||||||..||:.||.||.
Human    95 YQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS 159

  Fly    69 KGLQEGAEGFS----------DASEFFAQWFPFDRVSSEGRGRRNGKVVVK------VELTLEEI 117
            .|...||.|..          |..|.|.:.|.....||.|    :.:.|..      :|||..:.
Human   160 AGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFG----DFQTVFDQPQEYFMELTFNQA 220

  Fly   118 YVGGMKKKVEYNRQKLCSKCNGDG---GPKEAHESCETCGGAGRAAAFTFMGLSPF--DTTCPTC 177
             ..|:.|:...|....|.:|||.|   |.|..|  |..|||:|.....|    .||  .:||..|
Human   221 -AKGVNKEFTVNIMDTCERCNGKGNEPGTKVQH--CHYCGGSGMETINT----GPFVMRSTCRRC 278

  Fly   178 DGRGFTIRDDKKCSPCQGSGFVEQKMKRDLV-----VERGAPHMLKVPFANEGHQMRGGEFGDLI 237
            .|||..|  ...|..|:|:|..:|| ||.::     ||.|  ..:::|....          ::.
Human   279 GGRGSII--ISPCVVCRGAGQAKQK-KRVMIPVPAGVEDG--QTVRMPVGKR----------EIF 328

  Fly   238 VVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHL-DGRNVCLRTYPGEVLQHNQIKMV 301
            :.....:.|:|:|..|::: .||.|:|.:||.|.:...:.| :..||   |.|.......:|:| 
Human   329 ITFRVQKSPVFRRDGADIH-SDLFISIAQALLGGTARAQGLYETINV---TIPPGTQTDQKIRM- 388

  Fly   302 RGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEE-------- 358
            .|.|:|..| :...||.|:..|::.|..              |..||..:|...||:        
Human   389 GGKGIPRIN-SYGYGDHYIHIKIRVPKR--------------LTSRQQSLILSYAEDETDVEGTV 438

  Fly   359 --VQMTD-----------YKPQPRQQEDEDG 376
              |.:|.           .|.:....|||:|
Human   439 NGVTLTSSGGSTMDSSAGSKARREAGEDEEG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 120/395 (30%)
DnaJ 5..64 CDD:278647 29/59 (49%)
DnaJ_C 106..329 CDD:199909 69/239 (29%)
DnaJ_zf 134..197 CDD:199908 26/67 (39%)
DNAJA3NP_005138.3 DnaJ 90..480 CDD:223560 126/421 (30%)
DnaJ 93..155 CDD:278647 29/59 (49%)
DnaJ_C 207..416 CDD:199909 68/250 (27%)
DnaJ_zf 236..296 CDD:199908 26/67 (39%)
CXXCXGXG motif 236..243 4/6 (67%)
CXXCXGXG motif 253..260 4/6 (67%)
CXXCXGXG motif 275..282 3/6 (50%)
CXXCXGXG motif 289..296 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.