DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and APJ1

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:444 Identity:127/444 - (28%)
Similarity:197/444 - (44%) Gaps:110/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYD 64
            |.:|||.|.|...|:..||||.||..|.::|||||   .::..||:||..|||:|.|...|.:||
Yeast     4 NTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYD 68

  Fly    65 RYG-----------LKGLQEGAEGFSDASEF---------------FAQW--------------- 88
            :||           .:..::.|..||.:|.|               |||:               
Yeast    69 QYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGSKSS 133

  Fly    89 --FPFDRVSSEGRGRRNGKVV------------------------VK--VELTLEEIYVGGMKKK 125
              |.|:..|:......||..|                        :|  ::.||:|:|: |...|
Yeast   134 FNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLKCTLKELYM-GKTAK 197

  Fly   126 VEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMG--LSPFDTTCPTCDGRGFTIRDDK 188
            :..||.::||.|:|.||.|:.  :|:||.|.|.......||  :..:..||..|.|.|..:::..
Yeast   198 LGLNRTRICSVCDGHGGLKKC--TCKTCKGQGIQTQTRRMGPLVQSWSQTCADCGGAGVFVKNKD 260

  Fly   189 KCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQM---RGGEF-----GDLIVVISQMEH 245
            .|..|||.||::::....:.|:.|:.|...:....||.::   :||..     ||:::.|.:::.
Yeast   261 ICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKD 325

  Fly   246 PIFQ-RRHANLYMRDLEINITEALC-GYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPV 308
            |.|| ..::||..:..:|:...:|| |..:...|..|:.:.|...|||:|:....|.|...|||.
Yeast   326 PNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPK 390

  Fly   309 FNKATDS--GDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQ 360
            |.....|  |.||:||.|.:|:.          ||           |:||:::|
Yeast   391 FINGVRSGFGHLYVKFDVTYPER----------LE-----------PENAKKIQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 127/444 (29%)
DnaJ 5..64 CDD:278647 28/61 (46%)
DnaJ_C 106..329 CDD:199909 75/262 (29%)
DnaJ_zf 134..197 CDD:199908 23/64 (36%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 127/444 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52028
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43888
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.