DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and XDJ1

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_013191.1 Gene:XDJ1 / 850779 SGDID:S000004080 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:469 Identity:131/469 - (27%)
Similarity:189/469 - (40%) Gaps:117/469 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGD------KFKEISFAYEVLSDPEKRRIYD 64
            |||||.|..|||.:|||..|||||.:.||||..|...      |||||:.|||:||||||:..||
Yeast    10 LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYD 74

  Fly    65 RYG------LKGLQEGAEGFSDAS--EFFAQWF------------PFDRVSSEGRGRRNGKVVVK 109
            .||      ..|   ||.||.|..  .||..:|            .:| ...||....:..:.:.
Yeast    75 LYGDDNGAASSG---GANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYD-AYEEGNSTSSKDIDID 135

  Fly   110 VELTLEEIYVGGMKKKVEYNRQKLCSKCNGDG-GPKE----AHE-SCETCGGAGRAAAFTFMG-- 166
            :.|||:::|: |.|.|.:..||.:|.||:|.| .||.    .|: .||:|.|.|........|  
Yeast   136 ISLTLKDLYM-GKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPG 199

  Fly   167 -LSPFDTTCPTCDGRGFTIRDDKK----CSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGH 226
             ::.....|..|:|:|...:..|.    |..|.|.|.:.   |::::....||          ||
Yeast   200 LVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLS---KKEIITVNVAP----------GH 251

  Fly   227 QMRGGEFGDLIVVISQMEHPI-----------FQRRHANLYMR-----------------DLEIN 263
                 .|.|:|.|....:..|           ...:..||..:                 .:.|:
Yeast   252 -----HFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITIS 311

  Fly   264 ITEALCGYSHCF-KHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVF-NKATDSGDLYMKFKVKF 326
            ::|||.|:.... |..|.|.:.|...||.|::......:...|.|:. |.....||||:...::|
Yeast   312 LSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEF 376

  Fly   327 -PDNDFATAPQLAMLEDLLPPRQPIV--IPKNAEE--------------VQMTD--------YKP 366
             |||.|....:|..::..||......  ...|.|:              :..||        :||
Yeast   377 PPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIHTDDLPEGIRPFKP 441

  Fly   367 QPRQQEDEDGQSSH 380
            :.:....:..:||:
Yeast   442 EAQDSAHQKARSSY 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 125/442 (28%)
DnaJ 5..64 CDD:278647 36/63 (57%)
DnaJ_C 106..329 CDD:199909 65/266 (24%)
DnaJ_zf 134..197 CDD:199908 22/75 (29%)
XDJ1NP_013191.1 DnaJ 11..379 CDD:223560 115/390 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.