DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and MDJ1

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_116638.1 Gene:MDJ1 / 850530 SGDID:S000001878 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:468 Identity:126/468 - (26%)
Similarity:192/468 - (41%) Gaps:127/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPD--KNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            ||.|.:...||..||||.|.||||::|||  |.|||..||.::..|||:|||..||:.||::|..
Yeast    63 YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEKKFHDLQNAYEILSDETKRQQYDQFGPA 127

  Fly    70 ----GLQEGAEGFSDASEFFAQWF-----------PFDRVSSE--------GRGRRNG------- 104
                |...|..|....|.|.:|:.           ||..::.|        |.||.:|       
Yeast   128 AFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSS 192

  Fly   105 ----------KVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHE-SCETCGGAGR 158
                      ::|.||  :.::...|....::.::....||.|:|.|.....|: ||.||.|.|.
Yeast   193 MFRQYRGDPIEIVHKV--SFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTCHGTGT 255

  Fly   159 A----AAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKV 219
            .    ..|..|      :|||||:|.|...|....|:.|.|.| |:....:.:.|:  .||.|: 
Yeast   256 TVHIRGGFQMM------STCPTCNGEGTMKRPQDNCTKCHGEG-VQVNRAKTITVD--LPHGLQ- 310

  Fly   220 PFANEGHQMR---GGEF-----------------GDLIVVISQMEHPIFQRRHANLYMRDLEINI 264
                :|..:|   .|.:                 ||::|.|...:.|.|..::......|.||.|
Yeast   311 ----DGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPI 371

  Fly   265 TEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFK--VKFP 327
            |.|..|.:.....::|:.:.::..||  .|:||:..:...|:|  ..:|..||:.:::|  ||.|
Yeast   372 TTAALGGTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVP--KTSTIRGDMKVQYKIVVKKP 432

  Fly   328 ----------------DNDFA-------TAPQLAMLEDLLPPRQPIVIPKNAEEVQMTDYKPQPR 369
                            ::|.|       ||...|:.|::|..:      |..||         ..
Yeast   433 QSLAEKCLWEALADVTNDDMAKKTMQPGTAAGTAINEEILKKQ------KQEEE---------KH 482

  Fly   370 QQEDEDGQSSHFE 382
            .::|:|......|
Yeast   483 AKKDDDNTLKRLE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 123/447 (28%)
DnaJ 5..64 CDD:278647 31/58 (53%)
DnaJ_C 106..329 CDD:199909 66/265 (25%)
DnaJ_zf 134..197 CDD:199908 25/67 (37%)
MDJ1NP_116638.1 DnaJ 60..456 CDD:223560 115/412 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.