DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT1G80030

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_565227.1 Gene:AT1G80030 / 844343 AraportID:AT1G80030 Length:500 Species:Arabidopsis thaliana


Alignment Length:421 Identity:129/421 - (30%)
Similarity:195/421 - (46%) Gaps:68/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPD--KNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |..|.|:..|.::|||..||:||:::|||  |.|.|.:||||||.|||||||.:||.:||:||..
plant    77 YATLGVSKSANNKEIKAAYRRLARQYHPDVNKEPGATEKFKEISAAYEVLSDEQKRALYDQYGEA 141

  Fly    70 GLQE---GAEG------FSDASEFFAQ---WFPFDRVSSEGRGRRNGKVV----VKVELTLE-EI 117
            |::.   ||.|      |.....||..   .||....:..||.||: :|.    ::.::||| ..
plant   142 GVKSTVGGASGPYTSNPFDLFETFFGASMGGFPGMDQADFGRTRRS-RVTKGEDLRYDITLELSE 205

  Fly   118 YVGGMKKKVEYNRQKLCSKCNGDG---GPKEAHESCETCGGAGRA--AAFTFMGLSPFDTTCPTC 177
            .:.|.:|:.:....:.|..|.|.|   |.|  ...|.||||.|:.  ...|..|:....:.||.|
plant   206 AIFGSEKEFDLTHLETCEACAGTGAKAGSK--MRICSTCGGRGQVMRTEQTPFGMFSQVSICPNC 268

  Fly   178 DGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERG--APHMLKVPFANEGHQ-MRGGEFGDLIVV 239
            .|.|..|.::  |..|.|.|.|..|....:.:..|  |..:|:|  |.||.. .|||..|||.|.
plant   269 GGDGEVISEN--CRKCSGEGRVRIKKSIKVKIPPGVSAGSILRV--AGEGDSGPRGGPPGDLYVY 329

  Fly   240 ISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDG---RNVCLRTYPGEVLQHNQIKMV 301
            :...:....:|...|| :..|.|:..:|:.|.....|.::|   ..:...|.||:||      ::
plant   330 LDVEDVRGIERDGINL-LSTLSISYLDAILGAVVKVKTVEGDTELQIPPGTQPGDVL------VL 387

  Fly   302 RGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDL--------------LPPRQPIVI 352
            ...|:|..|:.:..||.....||..|:.  .:|.:..:||:|              ..|:||..:
plant   388 AKKGVPKLNRPSIRGDHLFTVKVSVPNQ--ISAGERELLEELASLKDTSSNRSRTRAKPQQPSTL 450

  Fly   353 ---PKNAEEVQMTDYKPQPRQQEDEDGQSSH 380
               |..:|     :.|.:.:::.:|..|.::
plant   451 STAPSGSE-----NKKDEVKEENEEPEQENY 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 126/402 (31%)
DnaJ 5..64 CDD:278647 32/58 (55%)
DnaJ_C 106..329 CDD:199909 68/238 (29%)
DnaJ_zf 134..197 CDD:199908 23/67 (34%)
AT1G80030NP_565227.1 PRK14293 74..436 CDD:237663 121/374 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.