DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT1G77930

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_565163.1 Gene:AT1G77930 / 844128 AraportID:AT1G77930 Length:271 Species:Arabidopsis thaliana


Alignment Length:174 Identity:43/174 - (24%)
Similarity:74/174 - (42%) Gaps:44/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPD---------KNPDAGDKFKEISFAYEVLSDPEKRRI 62
            ||.|::..:|.:|:||..||:|||.:|||         :...|..:|.:|..|||:|.|.||:..
plant    78 YDTLELDRNAEEEQIKVAYRRLAKFYHPDVYDGKGTLEEGETAEARFIKIQAAYELLMDSEKKVQ 142

  Fly    63 YD-----------RYGLKGLQEGAEGFSDASEF-FAQWFPFDRVSSEGRGRR----------NGK 105
            ||           :..::.|.:..:.|....:. .|.|....::....|.||          ..|
plant   143 YDMDNRVNPMKASQAWMEWLMKKRKAFDQRGDMAVAAWAEQQQLDINLRARRLSRSKVDPEEERK 207

  Fly   106 VVVKVELTLEEIYVGG-------------MKKKVEYNRQKLCSK 136
            ::.|.:....|::...             |:||.|.:::||.::
plant   208 ILEKEKKASRELFNSTLKRHTLVLKKRDLMRKKAEEDKKKLITQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 43/174 (25%)
DnaJ 5..64 CDD:278647 25/65 (38%)
DnaJ_C 106..329 CDD:199909 8/44 (18%)
DnaJ_zf 134..197 CDD:199908 0/3 (0%)
AT1G77930NP_565163.1 DnaJ 76..144 CDD:278647 25/65 (38%)
DnaJ 78..>145 CDD:223560 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.