DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT1G77020

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_177828.2 Gene:AT1G77020 / 844038 AraportID:AT1G77020 Length:379 Species:Arabidopsis thaliana


Alignment Length:246 Identity:68/246 - (27%)
Similarity:90/246 - (36%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68
            ||||.|.|.|::|||:|.|...|::.|||||   |.|.:||:.:..||:|||||..|..|||.| 
plant     8 YDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSDPVHREAYDRTG- 71

  Fly    69 KGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKL 133
             ......|...|.:..||..|     .||                |.|.|:|.:......:.|..
plant    72 -KFSAPKETMVDPTAVFALLF-----GSE----------------LFEDYIGHLAVASMASTQMA 114

  Fly   134 CSKCNGD-------GGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCS 191
            ....|.|       ...||..|:....             |..|.:.....|..||..|.:.:..
plant   115 SEIENSDQFQDKLKAVQKEREENLSRF-------------LKDFLSQYVHGDKEGFISRAESEAK 166

  Fly   192 PCQGSGF-------VEQKMKRDLVVERGAPHM-LKVPFA-----NEGHQMR 229
            ....:.|       :.....|....|.|...: |.|||.     |:||..:
plant   167 RLSDAAFGADMLHTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 68/246 (28%)
DnaJ 5..64 CDD:278647 30/59 (51%)
DnaJ_C 106..329 CDD:199909 27/144 (19%)
DnaJ_zf 134..197 CDD:199908 11/69 (16%)
AT1G77020NP_177828.2 DnaJ 7..>72 CDD:223560 34/65 (52%)
DnaJ 7..68 CDD:278647 30/59 (51%)
DnaJ-X 131..318 CDD:291006 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.