DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT1G44160

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_175080.2 Gene:AT1G44160 / 841019 AraportID:AT1G44160 Length:357 Species:Arabidopsis thaliana


Alignment Length:250 Identity:61/250 - (24%)
Similarity:97/250 - (38%) Gaps:65/250 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRA 159
            ||..:..:......|:..||||: ..|..||::..|..:.|          ..|.||        
plant   169 SSSAKVAKPSPTEKKLRCTLEEL-CNGCTKKIKIKRDVITS----------LGEKCE-------- 214

  Fly   160 AAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANE 224
                                                    |::|. ::.|:.|.....||.|..:
plant   215 ----------------------------------------EEEMV-EIKVKPGWKGGTKVTFEGK 238

  Fly   225 GHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYP 289
            |::.......||..||.:.||.:|:|...:|.|. :|:::.|||.|.......|||.|:.||.  
plant   239 GNEAMRSVPADLTFVIVEKEHEVFKREGDDLEMA-VEVSLLEALTGCELSVALLDGDNMRLRI-- 300

  Fly   290 GEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLL 344
            .:|:....:.:|:|.|||...:....|||.::|:.|||.:  .|..|.|.:..:|
plant   301 EDVIHPGYVTVVQGKGMPNLKEKGKRGDLRVRFRTKFPQH--LTDEQRAEIHSIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 60/249 (24%)
DnaJ 5..64 CDD:278647
DnaJ_C 106..329 CDD:199909 55/222 (25%)
DnaJ_zf 134..197 CDD:199908 4/62 (6%)
AT1G44160NP_175080.2 DnaJ_C 178..341 CDD:199909 55/227 (24%)
DnaJ <221..357 CDD:223560 43/137 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.