DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnaja2

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:406 Identity:160/406 - (39%)
Similarity:243/406 - (59%) Gaps:30/406 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLKG 70
            |||:|.|.|.|::.|:||.|||||||:||||||:||||||||||||||||:||||.:|||||.:|
  Rat     9 LYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQG 73

  Fly    71 LQEGAEGFSDASEFFAQWFP---FDRVSSEGR---GRRNGK-VVVKVELTLEEIYVGGMKKKVEY 128
            |:||:.|.....:.|:..|.   |..:.::.|   |||.|: ::..::::||::| .|...|::.
  Rat    74 LREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLY-NGKTTKLQL 137

  Fly   129 NRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSP-----FDTTCPTCDGRGFTIRDDK 188
            ::..|||.|:|.||...|.:.|..|  .||........|:|     ..:.|..|:|.|..|.:..
  Rat   138 SKNVLCSACSGQGGKSGAVQKCSAC--RGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKD 200

  Fly   189 KCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHA 253
            :|..|:|...:::....::.|::|..|..::.|..|..|..|.|.||:::::.:.||.:|||...
  Rat   201 RCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGN 265

  Fly   254 NLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDL 318
            :|:| ..:|.:.|||||:...|||||.|.:.::..||:|::...:::|||.|||.:....:.|||
  Rat   266 DLHM-TYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDL 329

  Fly   319 YMKFKVKFPDNDFATAPQLAMLEDLLP--PRQPIVIPKNAEEVQMTDYKP-------QPRQ---- 370
            |:||.|:||:|::....:|:.||||||  |..|.||.: .|||::.::..       |.|:    
  Rat   330 YIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNVIGE-TEEVELQEFDSTRGSGGGQRREAYND 393

  Fly   371 QEDEDGQSSHFEGVQC 386
            ..||:..|.|..||||
  Rat   394 SSDEESSSHHGPGVQC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 150/370 (41%)
DnaJ 5..64 CDD:278647 43/57 (75%)
DnaJ_C 106..329 CDD:199909 74/227 (33%)
DnaJ_zf 134..197 CDD:199908 21/67 (31%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 160/406 (39%)
CXXCXGXG motif 143..150 4/6 (67%)
CXXCXGXG motif 159..166 3/8 (38%)
CXXCXGXG motif 186..193 3/6 (50%)
CXXCXGXG motif 202..209 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6873
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43888
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.