DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT1G11040

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_172571.1 Gene:AT1G11040 / 837645 AraportID:AT1G11040 Length:438 Species:Arabidopsis thaliana


Alignment Length:287 Identity:70/287 - (24%)
Similarity:119/287 - (41%) Gaps:40/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PFDRVSSEGRGRRNGKV---VVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGD--GGPKEA--- 146
            ||  .|..|:.:..|.:   |.|:........:.|:|:....:..|..||.:.|  |....|   
plant   154 PF--TSPRGKDQTLGDLFGSVKKLSSPTSNSPINGVKQSSPSSISKSASKRDKDERGSTSSATST 216

  Fly   147 ----HESCETCGGAGR-AAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCS---PCQGSGFVEQKM 203
                .:|..|...||. |.:.:....:|...:..|...:...:....:|:   .|.| |....|:
plant   217 SLPYSKSKSTRDTAGSIAKSISRRSTTPIVFSQSTPPKKPPAVEKKLECTLEELCHG-GVKNIKI 280

  Fly   204 KRDLVVERG----APHML------------KVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRH 252
            |||::.:.|    ...||            |:.|...|::..|....|:..|:.:..||:|:||.
plant   281 KRDIITDEGLIMQQEEMLRVNIQPGWKKGTKITFEGVGNEKPGYLPEDITFVVEEKRHPLFKRRG 345

  Fly   253 ANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGD 317
            .:|.:. :||.:.:||.|.......|.|.::.:..  |:|:.|...|.::|.|||...:....||
plant   346 DDLEIA-VEIPLLKALTGCKLSVPLLSGESMSITV--GDVIFHGFEKAIKGQGMPNAKEEGKRGD 407

  Fly   318 LYMKFKVKFPDNDFATAPQLAMLEDLL 344
            |.:.|.|.||:.  .:..|.:|..::|
plant   408 LRITFLVNFPEK--LSEEQRSMAYEVL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 70/287 (24%)
DnaJ 5..64 CDD:278647
DnaJ_C 106..329 CDD:199909 62/254 (24%)
DnaJ_zf 134..197 CDD:199908 15/75 (20%)
AT1G11040NP_172571.1 DnaJ_C 259..420 CDD:199909 45/166 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.