DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and GFA2

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_568690.1 Gene:GFA2 / 834854 AraportID:AT5G48030 Length:456 Species:Arabidopsis thaliana


Alignment Length:371 Identity:115/371 - (30%)
Similarity:172/371 - (46%) Gaps:40/371 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRI 62
            |...:.|.||.|:.:|.:.||||.|..|||:.|||.|   |:|..||:|:|.|||:|.|.|||.:
plant    90 MSAKDYYSVLGVSKNAQEGEIKKAYYGLAKKLHPDMNKDDPEAETKFQEVSKAYEILKDKEKRDL 154

  Fly    63 YDRYGLKGLQEGAEGFSDASEFF-----AQWFPFDRVSSEGRGRRNGKVV-----------VKVE 111
            ||:.|.:..::.|.|.....:.|     ..:.|||..     |..||.:.           |||.
plant   155 YDQVGHEAFEQNASGGFPNDQGFGGGGGGGFNPFDIF-----GSFNGDIFNMYRQDIGGQDVKVL 214

  Fly   112 LTLEEI-YVGGMKKKVEYNRQKLCSKCNGDG-GPKEAHESCETCGGAGRAAAFTFMGLSPFDTTC 174
            |.|..: .|.|..|.|.:..:..|:.|.|.| .|....|.|:.|.|:|..:  ...|:....|||
plant   215 LDLSFMEAVQGCSKTVTFQTEMACNTCGGQGVPPGTKREKCKACNGSGMTS--LRRGMLSIQTTC 277

  Fly   175 PTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPH--MLKVPFANEGHQMRGGEFGDLI 237
            ..|.|.|.|.  ...|..|:|:..|..:....:.::.|..:  .|||.... |....|.:.|||.
plant   278 QKCGGAGQTF--SSICKSCRGARVVRGQKSVKVTIDPGVDNSDTLKVARVG-GADPEGDQPGDLY 339

  Fly   238 VVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVR 302
            |.:...|.|:|:|..::::: |..:::|:|:.|.:.....|.| :|.::..||....|..:  :|
plant   340 VTLKVREDPVFRREGSDIHV-DAVLSVTQAILGGTIQVPTLTG-DVVVKVRPGTQPGHKVV--LR 400

  Fly   303 GSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQ 348
            ..|:.. .|:|..||.|:.|.|..|.|  .|..|..:||:.....|
plant   401 NKGIRA-RKSTKFGDQYVHFNVSIPAN--ITQRQRELLEEFSKAEQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 115/371 (31%)
DnaJ 5..64 CDD:278647 31/61 (51%)
DnaJ_C 106..329 CDD:199909 65/237 (27%)
DnaJ_zf 134..197 CDD:199908 21/63 (33%)
GFA2NP_568690.1 DnaJ 90..450 CDD:223560 115/371 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.