powered by:
Protein Alignment DnaJ-H and AT5G37380
DIOPT Version :9
Sequence 1: | NP_001260431.1 |
Gene: | DnaJ-H / 34707 |
FlyBaseID: | FBgn0032474 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078673.1 |
Gene: | AT5G37380 / 833712 |
AraportID: | AT5G37380 |
Length: | 431 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 30/66 - (45%) |
Similarity: | 42/66 - (63%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDK--FKEISFAYEVLSDPEKRRIYD 64
::::.|.:|..:|...||.:|:.|||||...|||||...|.: ||.:|.|::.|||.|||..||
plant 63 EDVDWYGILNASPRDDDETLKRKYRKLALMLHPDKNKSIGAEGAFKHVSEAWKFLSDKEKRAAYD 127
Fly 65 R 65
|
plant 128 R 128
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.