DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT5G25530

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_197935.1 Gene:AT5G25530 / 832628 AraportID:AT5G25530 Length:347 Species:Arabidopsis thaliana


Alignment Length:408 Identity:114/408 - (27%)
Similarity:171/408 - (41%) Gaps:132/408 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYE--------VLSD 56
            |:.||:|||..:||::::||:|||||.::||||||    :|..|||:||.|||        ||||
plant     3 LDYYDILKVNRNATEDDLKKSYRKLAMKWHPDKNPNTKTEAEAKFKQISEAYEAKYEVMFQVLSD 67

  Fly    57 PEKRRIYDRYGLKGLQE-----------GAEGFS--DASEFFAQWF---PFDRVSSEGRGR---- 101
            |:||.:||:||.:||.:           .|.||:  :|.:.||::|   ||...|:.|.||    
plant    68 PQKRAVYDQYGEEGLSDMPPPGSTGNNGRAGGFNPRNAEDIFAEFFGSSPFGFGSAGGPGRSMRF 132

  Fly   102 ---------------RNGK--------------------VVVKVELTLEEIYVGGMKKKVEYNRQ 131
                           .||.                    |..|:..:|||:|.|..:|      .
plant   133 QSDGGGGMFGGFGGGNNGSENNIFRTYSEGTPAPKKPPPVESKLPCSLEELYSGSTRK------M 191

  Fly   132 KLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGS 196
            |: |:...|...::|.|                       |...|                    
plant   192 KI-SRSIVDANGRQAQE-----------------------TEILT-------------------- 212

  Fly   197 GFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLE 261
                      :||:.|.....|:.|.::|::.......||:.||.:..|.:| .|..|..:....
plant   213 ----------IVVKPGWKKGTKIKFPDKGNEQVNQLPADLVFVIDEKPHDLF-TRDGNDLITSRR 266

  Fly   262 INITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKF 326
            :.:.||:.|.:.....|||||  |.....|::......:|.|.|||:..:..:.|||.:||.|:|
plant   267 VTLAEAIGGTTVNINTLDGRN--LPVGVAEIVSPGYEFVVPGEGMPIAKEPRNKGDLKIKFDVQF 329

  Fly   327 PDNDFATAPQLAMLEDLL 344
            |..  .|..|.:.|:.:|
plant   330 PAR--LTTEQKSALKRVL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 114/408 (28%)
DnaJ 5..64 CDD:278647 36/70 (51%)
DnaJ_C 106..329 CDD:199909 52/222 (23%)
DnaJ_zf 134..197 CDD:199908 6/62 (10%)
AT5G25530NP_197935.1 DnaJ 1..342 CDD:223560 112/403 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.