DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT5G23590

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001031930.1 Gene:AT5G23590 / 832425 AraportID:AT5G23590 Length:296 Species:Arabidopsis thaliana


Alignment Length:367 Identity:73/367 - (19%)
Similarity:114/367 - (31%) Gaps:138/367 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVLKVAPDATDEEIKKNYRKLAKEFHPDK---NPDAGDKFKEISFAYEVLSDPEKRRIYD----- 64
            :.||:    |::||.|.|:..|.:.||||   :|||.:||:.:..:||||.|.:.|:::|     
plant    18 EALKL----TEKEIAKAYKLKALDLHPDKRPDDPDAHEKFQRLKTSYEVLKDEKARKLFDDLLRI 78

  Fly    65 ---------------RYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTL 114
                           |..:..|:|     .:.|.|...  |..|...|     ..::..|::..:
plant    79 QREKQHKKSQVDSKRRKMMSDLEE-----RERSAFSPN--PSARAYDE-----EERIARKLKEEI 131

  Fly   115 EEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDG 179
            :.|.....|||..:.    ..:.|.|...||..                              .|
plant   132 DRIRARHAKKKSGFQ----TPESNVDEKRKEER------------------------------SG 162

  Fly   180 RGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQME 244
            .|.:::.||:                         .||||.:...|.....|...::.....::|
plant   163 AGASVQLDKE-------------------------RMLKVSWEKSGEGYTAGRLREVFSEFGEVE 202

  Fly   245 HPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVF 309
                          |:.|..|:..|.........||.....||..|.:                 
plant   203 --------------DVVIRSTKKKCSALIVMATKDGAVAATRTLCGNL----------------- 236

  Fly   310 NKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIV 351
                 |..|.:....|....||.||.:.|..|    |:..||
plant   237 -----SNPLLVVPLQKAAQTDFLTAKKSAEAE----PQSNIV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 73/367 (20%)
DnaJ 5..64 CDD:278647 23/58 (40%)
DnaJ_C 106..329 CDD:199909 32/222 (14%)
DnaJ_zf 134..197 CDD:199908 8/62 (13%)
AT5G23590NP_001031930.1 CbpA 1..>177 CDD:225124 47/233 (20%)
DnaJ 6..73 CDD:395170 23/58 (40%)
RRM_DNAJC17 173..245 CDD:409863 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.