DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and J2

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_568412.1 Gene:J2 / 832267 AraportID:AT5G22060 Length:419 Species:Arabidopsis thaliana


Alignment Length:411 Identity:144/411 - (35%)
Similarity:217/411 - (52%) Gaps:31/411 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRIYDRY 66
            ||...|::|.|...|..|::||.|:|.|.:.||||..|. :||||::.|||||||||||.|||:|
plant    11 DNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDP-EKFKELAQAYEVLSDPEKREIYDQY 74

  Fly    67 GLKGLQE---GAEGFSDASEFFAQWF-----PFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMK 123
            |...|:|   |..|..|..:.|:.:|     ||...|...|.||...||..::::||::|: |..
plant    75 GEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGEDVVHPLKVSLEDVYL-GTT 138

  Fly   124 KKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMG---LSPFDTTCPTCDGRGFTIR 185
            ||:..:|:.|||||||.|....|...|..|.|:|...:....|   :......|..|.|.|.||.
plant   139 KKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETIN 203

  Fly   186 DDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQR 250
            |..:|..|:|...|.:|...::.||:|..|..|:.|:.:..:......||::.||.|.|||.|:|
plant   204 DRDRCPQCKGEKVVSEKKVLEVNVEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKR 268

  Fly   251 RHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDS 315
            :..:|:: :..|::||||||:.....|||.|.:.:::.||||::.:..|.:...|||::.:....
plant   269 KGEDLFV-EHTISLTEALCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMK 332

  Fly   316 GDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIP----KNAEEVQMTDY--------KPQP 368
            |.||:.|.|:||::  .:..|...:|.:||......|.    .:.||..:.|.        |.|.
plant   333 GKLYIHFTVEFPES--LSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQA 395

  Fly   369 RQQEDEDGQSSHFEG---VQC 386
            :::..:|.:..|..|   |||
plant   396 QREAYDDDEEDHPGGAQRVQC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 135/375 (36%)
DnaJ 5..64 CDD:278647 31/58 (53%)
DnaJ_C 106..329 CDD:199909 78/225 (35%)
DnaJ_zf 134..197 CDD:199908 23/65 (35%)
J2NP_568412.1 PTZ00037 7..419 CDD:240236 144/411 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43888
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.