DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT5G05750

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_196194.1 Gene:AT5G05750 / 830459 AraportID:AT5G05750 Length:294 Species:Arabidopsis thaliana


Alignment Length:116 Identity:37/116 - (31%)
Similarity:57/116 - (49%) Gaps:30/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |::|.:..:.:.|:::|:||||:.:.|||||  |.:.:.||.:|.|::.||:.:.||.||.   .
plant   116 YEILGLKSNCSVEDLRKSYRKLSLKVHPDKNKAPGSEEAFKSVSKAFQCLSNEDTRRKYDG---S 177

  Fly    70 GLQEGA----------EGFS-------DASEFFAQWFPFDRVSSEGRGRRN 103
            |..|.|          .||:       ||.|.|..:|        |.|..|
plant   178 GSDEPAYQPRRDARRNNGFNGFYDDEFDADEIFRSFF--------GGGEMN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 37/116 (32%)
DnaJ 5..64 CDD:278647 22/58 (38%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
AT5G05750NP_196194.1 DnaJ 110..>217 CDD:223560 35/111 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.