DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT4G39960

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001329618.1 Gene:AT4G39960 / 830157 AraportID:AT4G39960 Length:447 Species:Arabidopsis thaliana


Alignment Length:355 Identity:126/355 - (35%)
Similarity:172/355 - (48%) Gaps:51/355 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYG 67
            :.|.||.|:.:||..|||..|||||:.:|||.|.|||  |||||||.|||:|||.|||.:|||||
plant    85 DFYSVLGVSKNATKAEIKSAYRKLARSYHPDVNKDAGAEDKFKEISNAYEILSDDEKRSLYDRYG 149

  Fly    68 LKGLQ-EGAEGFSDASEFFAQWFPFDRVSS--EG-------------RGRRNGKVVVKVE----- 111
            ..|:: .|..|..|.|.      |||...|  ||             ||.|:..:..:.|     
plant   150 EAGVKGAGMGGMGDYSN------PFDLFESLFEGMGGMGGMGGGMGSRGSRSRAIDGEDEYYSLI 208

  Fly   112 LTLEEIYVGGMKKKVEYNRQKLCSKCNGDG---GPKEAHESCETCGGAGRAAAFTFMGLSPFD-- 171
            |..:|. |.|::|::|.:|.:.|..|||.|   |.|..  .|:||||.|:..|.|...|..|.  
plant   209 LNFKEA-VFGIEKEIEISRLESCGTCNGSGAKAGTKPT--KCKTCGGQGQVVASTRTPLGVFQQV 270

  Fly   172 TTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQ-MRGGEFGD 235
            .||..|:|.|   ...|.|..|.|.|.|.:..:..|.|..|.....::....||:. .|||..||
plant   271 MTCSPCNGTG---EISKPCGACSGDGRVRRTKRISLKVPAGVDSGSRLRVRGEGNAGKRGGSPGD 332

  Fly   236 LIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGR---NVCLRTYPGEVLQHNQ 297
            |..||..:..|:.:|...|: :...:|:..:|:.|.:.....:||.   .|...|.|...|    
plant   333 LFAVIEVIPDPVLKRDDTNI-LYTCKISYVDAILGTTLKVPTVDGEVDLKVPAGTQPSTTL---- 392

  Fly   298 IKMVRGSGMPVFNKATDSGDLYMKFKVKFP 327
              ::...|:||.||:...||..::.:|:.|
plant   393 --VMAKKGVPVLNKSKMRGDQLVRVQVEIP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 126/355 (35%)
DnaJ 5..64 CDD:278647 37/60 (62%)
DnaJ_C 106..329 CDD:199909 70/236 (30%)
DnaJ_zf 134..197 CDD:199908 26/67 (39%)
AT4G39960NP_001329618.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.