powered by:
Protein Alignment DnaJ-H and J11
DIOPT Version :9
Sequence 1: | NP_001260431.1 |
Gene: | DnaJ-H / 34707 |
FlyBaseID: | FBgn0032474 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195328.1 |
Gene: | J11 / 829760 |
AraportID: | AT4G36040 |
Length: | 161 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 33/71 - (46%) |
Similarity: | 45/71 - (63%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPD------KNPDAGDKFKEISFAYEVLSDPEKRRIY 63
:|||||:|...||.::||..||:||:..||| .:..:.|:|.:|..||..|||||||.:|
plant 65 SLYDVLEVPLGATSQDIKSAYRRLARICHPDVAGTDRTSSSSADEFMKIHAAYCTLSDPEKRSVY 129
Fly 64 DRYGLK 69
||..|:
plant 130 DRRMLR 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0712 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.