DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT4G28480

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_194577.1 Gene:AT4G28480 / 828965 AraportID:AT4G28480 Length:348 Species:Arabidopsis thaliana


Alignment Length:396 Identity:115/396 - (29%)
Similarity:170/396 - (42%) Gaps:106/396 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYEVLSDPEKRRIYD 64
            ::.|.||:|...|.|:::||.|||||.::||||||    ||..|||:||.||:|||||:||.:||
plant     3 VDYYKVLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAVYD 67

  Fly    65 RYGLKGLQ----------EGAEGFS-------------DASEFFAQWFPFDRVSSEGRGRRNGKV 106
            :||.:||:          .||..||             .|.:.||::|.|......|.|...|  
plant    68 QYGEEGLKGNVPPPNAATSGASYFSTGDGSSSFRFNPRSADDIFAEFFGFSTPFGGGGGGTGG-- 130

  Fly   107 VVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESC-ETCGGAG----------RAA 160
                                    |:..|:..||    :.:.|. |..||.|          .||
plant   131 ------------------------QRFASRMFGD----DMYASFGEGAGGGGAMHHHHHHHHHAA 167

  Fly   161 AFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLV----------------V 209
            |   ..::|.:...| |..........||           .|:.|::|                |
plant   168 A---RKVAPIENKLP-CSLEDLYKGTTKK-----------MKISREIVDVSGKAMQVEEILTIGV 217

  Fly   210 ERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHC 274
            :.|.....|:.|..:|::..|....||:.:|.:..||:|.|...:|.:.. ::::.:||.||:..
plant   218 KPGWKKGTKITFPEKGNEHPGVIPADLVFIIDEKPHPVFTREGNDLIVTQ-KVSLADALTGYTAN 281

  Fly   275 FKHLDGRNVCLRTYP-GEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLA 338
            ...||||.:   |.| ..|:.....::|...|||:....|..|:|.:||.:|||..  .||.|.|
plant   282 IATLDGRTL---TIPITNVIHPEYEEVVPKEGMPLQKDQTKKGNLRIKFNIKFPAR--LTAEQKA 341

  Fly   339 MLEDLL 344
            ..:.|:
plant   342 GFKKLI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 115/396 (29%)
DnaJ 5..64 CDD:278647 35/62 (56%)
DnaJ_C 106..329 CDD:199909 57/250 (23%)
DnaJ_zf 134..197 CDD:199908 16/73 (22%)
AT4G28480NP_194577.1 DnaJ 1..346 CDD:223560 114/393 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.