DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and NdhT

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_192673.1 Gene:NdhT / 826517 AraportID:AT4G09350 Length:249 Species:Arabidopsis thaliana


Alignment Length:118 Identity:38/118 - (32%)
Similarity:53/118 - (44%) Gaps:31/118 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN----PDAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |..|.|:.||..||||..||:|:||:|||..    ..|.:||.::...|.||||.|.||.||   
plant   108 YQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSDEETRRFYD--- 169

  Fly    68 LKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVG 120
                                |    .::.|...|:..|:.:|:|...|:.:.|
plant   170 --------------------W----TLAQEVASRQAEKMRMKLEDPKEQDFRG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 38/118 (32%)
DnaJ 5..64 CDD:278647 28/60 (47%)
DnaJ_C 106..329 CDD:199909 4/15 (27%)
DnaJ_zf 134..197 CDD:199908
NdhTNP_192673.1 DnaJ 106..169 CDD:278647 28/60 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.