DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and ATERDJ3B

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:347 Identity:113/347 - (32%)
Similarity:167/347 - (48%) Gaps:66/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDK---NPDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68
            ||||:|...|:||:||:.|||||.::||||   |.:|..||.||:.|||||||.|||.||::||.
plant    28 YDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIYNKYGE 92

  Fly    69 KGLQE--------GAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGG-MKK 124
            :||::        |..|..:..:.|:.:|....:..|.:..:...|:|::|.|||::|:|| ||.
plant    93 EGLKQFSANGGRGGGGGGMNMQDIFSSFFGGGSMEEEEKVVKGDDVIVELEATLEDLYMGGSMKV 157

  Fly   125 KVEYNRQKLC---SKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTC-----DGRG 181
            ..|.|..|..   .|||.      .:|......|.|.....|       :..|..|     :..|
plant   158 WREKNVIKPAPGKRKCNC------RNEVYHRQIGPGMFQQMT-------EQVCDKCPNVKYEREG 209

  Fly   182 FTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHP 246
            :.:..|                     :|:|.....:|.|..:|..:..|:.|||...|....|.
plant   210 YFVTVD---------------------IEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIRTAPHA 253

  Fly   247 IFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLR----TYPGEVLQHNQIKMVRGSGMP 307
            .|:|...:|:| ::.|.:.|||.|:...|||||...|.:.    |.|.||      |..:|.|||
plant   254 RFRRDGNDLHM-NVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEV------KKFKGEGMP 311

  Fly   308 VFNKATDSGDLYMKFKVKFPDN 329
            : :.:|..|:|::.|:|.||.:
plant   312 L-HYSTKKGNLFVTFEVLFPSS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 113/347 (33%)
DnaJ 5..64 CDD:278647 36/59 (61%)
DnaJ_C 106..329 CDD:199909 67/235 (29%)
DnaJ_zf 134..197 CDD:199908 11/70 (16%)
ATERDJ3BNP_191819.1 DnaJ 23..343 CDD:223560 113/347 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.