DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G57340

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_191293.1 Gene:AT3G57340 / 824901 AraportID:AT3G57340 Length:367 Species:Arabidopsis thaliana


Alignment Length:145 Identity:37/145 - (25%)
Similarity:64/145 - (44%) Gaps:31/145 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |::|.:..:.:.::::|.||||:.:.|||||  |.:.:.||.:|.|::.||:.|.|:.||   :.
plant   115 YEILGLESNCSVDDVRKAYRKLSLKVHPDKNQAPGSEEAFKSVSKAFQCLSNDEARKKYD---VS 176

  Fly    70 GLQE---------GAEGFS---------DASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEE 116
            |..|         .:.||:         |.:|.|..:|        |.|...|..:.........
plant   177 GSDEPIYQPRRSARSNGFNGGYYYEDEFDPNEIFRSFF--------GGGGFGGGGMPPATAQFRS 233

  Fly   117 IYVGGMKKKVEYNRQ 131
            ...|..:::...|.|
plant   234 FNFGATRQRTANNNQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 37/145 (26%)
DnaJ 5..64 CDD:278647 21/58 (36%)
DnaJ_C 106..329 CDD:199909 3/26 (12%)
DnaJ_zf 134..197 CDD:199908
AT3G57340NP_191293.1 DnaJ 109..>210 CDD:223560 29/97 (30%)
DnaJ 113..174 CDD:278647 21/58 (36%)
DUF1977 277..361 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.