DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G47940

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 / 823949 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana


Alignment Length:409 Identity:100/409 - (24%)
Similarity:168/409 - (41%) Gaps:133/409 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP-----DAGDKFKEISFAYEVLSDPEKRRIY 63
            ::.|::|||..:||::::||.|::||..:||||||     :|..|||.||.||:|||||:||:||
plant     3 VDYYNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRDEAEAKFKRISEAYDVLSDPQKRQIY 67

  Fly    64 DRYGLKGLQEG----------------------------------AEGF----SDASEFFAQWFP 90
            |.||.:||:.|                                  |..|    .||.:.:|::|.
plant    68 DLYGEEGLKSGKIPNSSSSEASSSSSSSSSRYPHFHQHRPQHPPNASSFRFNPRDAEDIYAEFFG 132

  Fly    91 FDR----VSSEGRGRR------------NG-----KVVVKVE----LTLEEIYVGGMKKKVEYNR 130
            .:.    .::.|||.|            ||     :.|..:|    ::||::|.|.:||      
plant   133 SENGGGSNNAGGRGNRAFRNGHFNTGGANGYSGEMRKVPAMENPLPVSLEDLYKGVVKK------ 191

  Fly   131 QKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQG 195
                                                                 :|..:......|
plant   192 -----------------------------------------------------MRITRNVYDASG 203

  Fly   196 SGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDL 260
            ...||.:: ..:.::.|.....|:.|..:|::..|....|::.|:.:..||:: :|..|..:...
plant   204 RMMVEAEI-LPIEIKPGWKKGTKLTFPKKGNEEPGIIPADIVFVVEEKPHPVY-KRDGNDLLVSQ 266

  Fly   261 EINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVK 325
            ||.:.|||.|.:.....||||.:.:..  .|:::.:...:|...|||:..:....|:|.:|..||
plant   267 EITLLEALTGKTVNLITLDGRTLMIPL--TEIIKPDHEIVVPNEGMPISKEPGKKGNLKLKLSVK 329

  Fly   326 FPDNDFATAPQLAMLEDLL 344
            :|..  .|:.|...|:.:|
plant   330 YPSR--LTSDQKFELKRVL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 100/409 (24%)
DnaJ 5..64 CDD:278647 33/63 (52%)
DnaJ_C 106..329 CDD:199909 44/226 (19%)
DnaJ_zf 134..197 CDD:199908 2/62 (3%)
AT3G47940NP_190377.1 DnaJ 1..344 CDD:223560 99/405 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.