DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G14200

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_188036.1 Gene:AT3G14200 / 820637 AraportID:AT3G14200 Length:230 Species:Arabidopsis thaliana


Alignment Length:68 Identity:28/68 - (41%)
Similarity:39/68 - (57%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK------NPDAGDKFKEISFAYEVLSDPEKRR 61
            |.|||.||.:..:.:..|::..|:|||..:|||:      ..:|..||:.|..||.||||..||.
plant    10 NENLYAVLGLKKECSKTELRSAYKKLALRWHPDRCSSMEFVEEAKKKFQAIQEAYSVLSDSNKRF 74

  Fly    62 IYD 64
            :||
plant    75 LYD 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 28/68 (41%)
DnaJ 5..64 CDD:278647 25/64 (39%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
AT3G14200NP_188036.1 DnaJ 12..77 CDD:395170 25/64 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.