DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G12170

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001325582.1 Gene:AT3G12170 / 820394 AraportID:AT3G12170 Length:298 Species:Arabidopsis thaliana


Alignment Length:166 Identity:50/166 - (30%)
Similarity:74/166 - (44%) Gaps:47/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRY 66
            |||:||.|...|:.:||:|.|.|||...|||||   .||.:||:::.....:|.|.|||.:||: 
plant    47 NLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEKRAVYDQ- 110

  Fly    67 GLKGLQEGAEGFSDASEFFAQWFP--FDRVSSEGRGRRNGKVVVKVELTLEEI---YVGGMKKKV 126
              .|..:.|:...|..:....:|.  :.:|:.|               .:||.   |.|...:|.
plant   111 --TGSVDDADLSGDVVDNLRDFFKAMYKKVTEE---------------DIEEFEANYRGSESEKN 158

  Fly   127 E----YNRQK----------LCSKCNGDGGPK-EAH 147
            :    ||:.|          |||      .|| ::|
plant   159 DLIELYNKFKGKMSRLFCSMLCS------NPKLDSH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 50/166 (30%)
DnaJ 5..64 CDD:278647 28/61 (46%)
DnaJ_C 106..329 CDD:199909 14/60 (23%)
DnaJ_zf 134..197 CDD:199908 5/15 (33%)
AT3G12170NP_001325582.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.