DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and ATERDJ3A

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001319504.1 Gene:ATERDJ3A / 820049 AraportID:AT3G08970 Length:572 Species:Arabidopsis thaliana


Alignment Length:355 Identity:82/355 - (23%)
Similarity:124/355 - (34%) Gaps:119/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.|:.||...||:|.:.|.:.::|||||.|.|  :||.||:.|||:|||.|||:.||.|   
plant    29 YKVLGVSKDAKQREIQKAFHKQSLKYHPDKNKDKGAQEKFAEINNAYEILSDEEKRKNYDLY--- 90

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDR----VSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNR 130
            |.::|..||...       ||...    .||.|.|...|                          
plant    91 GDEKGQPGFDSG-------FPGGNGGYSYSSSGGGFNFG-------------------------- 122

  Fly   131 QKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRD--------- 186
                    |.||       .:..||.|.:.:|:|....|.:::.      ||.:.|         
plant   123 --------GPGG-------WQNMGGGGGSKSFSFSFGGPSESSF------GFGMDDIFSMFSGGS 166

  Fly   187 --DKKCSPCQGSGF-----VEQKMKRDL---------------VVERGAPHMLKVPFANEGHQMR 229
              .|:    |..||     .|.|.|...               ||::|...:|.....::    |
plant   167 SKGKE----QFGGFGSSSNAESKSKSSTVAAIKTINSQVYKKDVVDQGMTWLLLSYLPSQ----R 223

  Fly   230 GGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGY----------SHCFKHLDGRNVC 284
            |.::.:.|:      ..:.:.....|.:..|......:||..          ...:.:.......
plant   224 GSQYHESII------EEVAESLQGALKVGRLNCETESSLCKQLGIVPRRAPRMFVYSYTSSGKAT 282

  Fly   285 LRTYPGEVLQHNQIKMVRGSGMPVFNKATD 314
            |..|..|::. .::|......:|.|:|..|
plant   283 LAEYTEELVA-KKVKSFCQEHLPRFSKKID 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 82/355 (23%)
DnaJ 5..64 CDD:278647 30/58 (52%)
DnaJ_C 106..329 CDD:199909 38/250 (15%)
DnaJ_zf 134..197 CDD:199908 14/73 (19%)
ATERDJ3ANP_001319504.1 DnaJ 24..>172 CDD:223560 57/203 (28%)
Thioredoxin_like 205..>262 CDD:381987 11/66 (17%)
Thioredoxin_like 435..558 CDD:381987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.