DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G08910

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:367 Identity:110/367 - (29%)
Similarity:167/367 - (45%) Gaps:107/367 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYEVLSDPEKRRIYD 64
            ::.|.||:|..:|.|:::||.|||||.::||||||    ||..|||:||.||:|||||:||.|||
plant     3 VDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAIYD 67

  Fly    65 RYGLKGLQEGAE------GFSD-----------ASEFFAQWFPFDRVSSEGRG------------ 100
            :||.:||...|.      ||||           |.:.|:::|.|.|...:.||            
plant    68 QYGEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPFGDSRGAGPSNGFRFAED 132

  Fly   101 ---------RRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGA 156
                     |:...:..::..:||::| .|:.||::.:|..|.|                    :
plant   133 VFSSNVVPPRKAAPIERQLPCSLEDLY-KGVSKKMKISRDVLDS--------------------S 176

  Fly   157 GRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPF 221
            ||                ||......||.                       ::.|.....|:.|
plant   177 GR----------------PTTVEEILTIE-----------------------IKPGWKKGTKITF 202

  Fly   222 ANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLR 286
            ..:|::.||....||:.::.:..|.:|:|...:|.|.. :|.:.|||.||:.....||||:|   
plant   203 PEKGNEQRGIIPSDLVFIVDEKPHAVFKRDGNDLVMTQ-KIPLVEALTGYTAQVSTLDGRSV--- 263

  Fly   287 TYP-GEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFP 327
            |.| ..|:..:..::|:|.|||:....:..|:|.:||.||||
plant   264 TVPINNVISPSYEEVVKGEGMPIPKDPSKKGNLRIKFTVKFP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 110/367 (30%)
DnaJ 5..64 CDD:278647 36/62 (58%)
DnaJ_C 106..329 CDD:199909 55/223 (25%)
DnaJ_zf 134..197 CDD:199908 7/62 (11%)
AT3G08910NP_187503.1 DnaJ 1..313 CDD:223560 110/367 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.