DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT3G04980

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001326461.1 Gene:AT3G04980 / 819658 AraportID:AT3G04980 Length:1183 Species:Arabidopsis thaliana


Alignment Length:377 Identity:92/377 - (24%)
Similarity:128/377 - (33%) Gaps:135/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDK--FKEISFAYEVLSDPEKRRIYD-RYGL 68
            |.||:|.|.|..:.|||.|||||...|||||..||.:  ||.:..|..:|||..||..|| ||  
plant    68 YGVLQVQPYADADTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQYDNRY-- 130

  Fly    69 KGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKL 133
                       .:...||                |..|         .:|.|           :.
plant   131 -----------RSHSMFA----------------NRHV---------NVYSG-----------RH 148

  Fly   134 CSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFT-----IRDDKKCSPC 193
            |:..|.                    ||....|:..|.|.|..| |:.:.     :.....||.|
plant   149 CAATNN--------------------AAENIAGVFTFWTRCRHC-GQCYKYLREYMNTSMHCSSC 192

  Fly   194 QGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMR 258
            |.| ||..||:.|     |.|     |.::...:.   ||.|.::..:       .|::|:    
plant   193 QKS-FVACKMRCD-----GVP-----PSSSTAGRK---EFQDQVMSNT-------SRQNAS---- 232

  Fly   259 DLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFK 323
                  |.|..|.|......:|:      ..|:|.:.||.|...|:    .|:.|       |.:
plant   233 ------TAAESGSSAADMGKNGK------VGGKVNKKNQEKQKNGA----VNRGT-------KKE 274

  Fly   324 VKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQMTDYKPQPRQQEDED 375
            ....:||         .|...|.........:||..:....|||.:.:|:.|
plant   275 EGCTEND---------AEGRKPQTSETGTNISAEMPKADVLKPQHQVKEEPD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 87/363 (24%)
DnaJ 5..64 CDD:278647 29/58 (50%)
DnaJ_C 106..329 CDD:199909 45/227 (20%)
DnaJ_zf 134..197 CDD:199908 14/67 (21%)
AT3G04980NP_001326461.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.