DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and OWL1

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_181115.2 Gene:OWL1 / 818142 AraportID:AT2G35720 Length:538 Species:Arabidopsis thaliana


Alignment Length:185 Identity:61/185 - (32%)
Similarity:87/185 - (47%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPD----AGDKFKEISFAYEVLSDPEKRR 61
            |..||.:|.::|:|:||||:|.||:.|:.:||||  :|.    |.:.|:.|..|||:|||..||.
plant    13 NRELYALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENFQRICEAYEILSDETKRL 77

  Fly    62 IYDRYGLKGLQEGAE---GFSDASEFFAQWFPFDRVSSEGRG----RRNGKVVVKVELTLEEIYV 119
            |||.||::||..|.|   ..|.|.|...:.....|.:.|.:.    :..|.::  ..|::....|
plant    78 IYDLYGMEGLNSGLELGPRLSKADEIKEELERIKRRNEEAKKMAHFQPTGSIL--FNLSVPHFLV 140

  Fly   120 G-----GMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSP 169
            |     ||....:...|.........||...|:|.    .|.|.|.|.....:||
plant   141 GDGIMRGMVMASQVQSQLSKDDAIAIGGNLAANEK----SGGGVATAILRRQISP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 61/185 (33%)
DnaJ 5..64 CDD:278647 30/64 (47%)
DnaJ_C 106..329 CDD:199909 16/69 (23%)
DnaJ_zf 134..197 CDD:199908 10/36 (28%)
OWL1NP_181115.2 DnaJ 13..>90 CDD:223560 37/76 (49%)
DnaJ 15..80 CDD:278647 30/64 (47%)
DUF3395 396..534 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.