DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT2G22360

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_565533.1 Gene:AT2G22360 / 816768 AraportID:AT2G22360 Length:442 Species:Arabidopsis thaliana


Alignment Length:356 Identity:128/356 - (35%)
Similarity:183/356 - (51%) Gaps:34/356 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPD--KNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.|:.:||..|||..|||||:.:|||  |:|.|.:||||||.|||||||.||:.:|||||..
plant    88 YSVLGVSKNATKAEIKSAYRKLARNYHPDVNKDPGAEEKFKEISNAYEVLSDDEKKSLYDRYGEA 152

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSS--------EGRGRRNGKVVVKVE-----LTLEEIYVGG 121
            || :||.||.:..  |:.  |||...|        .|||.|:..|..:.|     |..:|. |.|
plant   153 GL-KGAAGFGNGD--FSN--PFDLFDSLFEGFGGGMGRGSRSRAVDGQDEYYTLILNFKEA-VFG 211

  Fly   122 MKKKVEYNRQKLCSKCNGDGG-PKEAHESCETCGGAGR--AAAFTFMGLSPFDTTCPTCDGRGFT 183
            |:|::|.:|.:.|..|.|.|. |......|.||||.|:  :||.|.:|:.....||.:|:|.|  
plant   212 MEKEIEISRLESCGTCEGSGAKPGTKPTKCTTCGGQGQVVSAARTPLGVFQQVMTCSSCNGTG-- 274

  Fly   184 IRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQ-MRGGEFGDLIVVISQMEHPI 247
             .....|..|.|.|.|.:..:..|.|..|.....::....||:. .|||..|||.|||..:..||
plant   275 -EISTPCGTCSGDGRVRKTKRISLKVPAGVDSGSRLRVRGEGNAGKRGGSPGDLFVVIEVIPDPI 338

  Fly   248 FQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKA 312
            .:|...|: :...:|:..:|:.|.:.....:|| .|.|:...|  .|.:...::...|:||.||:
plant   339 LKRDDTNI-LYTCKISYIDAILGTTLKVPTVDG-TVDLKVPAG--TQPSTTLVMAKKGVPVLNKS 399

  Fly   313 TDSGDLYMKFKVKFPDNDFATAPQLAMLEDL 343
            ...||..::.:|:.|..  .:..:..::|:|
plant   400 NMRGDQLVRVQVEIPKR--LSKEEKKLIEEL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 128/356 (36%)
DnaJ 5..64 CDD:278647 35/58 (60%)
DnaJ_C 106..329 CDD:199909 71/231 (31%)
DnaJ_zf 134..197 CDD:199908 23/65 (35%)
AT2G22360NP_565533.1 DnaJ_bact 86..432 CDD:274090 128/356 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.