DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT2G21510

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001324689.1 Gene:AT2G21510 / 816690 AraportID:AT2G21510 Length:353 Species:Arabidopsis thaliana


Alignment Length:239 Identity:71/239 - (29%)
Similarity:104/239 - (43%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68
            |::|.|..||:|.||||.|...|::.|||||   |.|...|:.:..||:|||:|:||..||:||.
plant     8 YEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSNPDKRAAYDKYGK 72

  Fly    69 KGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKL 133
            :|:|:.|  ..|.:..|...|. ..|..|..|:.....:..:|..||. :...::|::..::.|.
plant    73 EGVQQDA--MVDPAAVFGMLFG-SEVFEEYVGQLALAYLASIEADLES-HDPEIRKQMLQDKIKA 133

  Fly   134 CSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGF 198
            ..|...|                 :.||.....|.|| ....|.:...:...:.|:.|   .:||
plant   134 LQKERED-----------------KLAATLKNKLEPF-VERQTDEFIEWANEEAKRLS---SAGF 177

  Fly   199 VEQKM-------KRDLVVERGA-PHMLKVPFANE-----GHQMR 229
            .|..|       .|....|.|. ...:||||..|     ||.|:
plant   178 GEAMMHTIGYIYTRKAAKEIGKDKRYMKVPFLAEWVRDKGHHMK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 71/239 (30%)
DnaJ 5..64 CDD:278647 28/59 (47%)
DnaJ_C 106..329 CDD:199909 30/137 (22%)
DnaJ_zf 134..197 CDD:199908 10/62 (16%)
AT2G21510NP_001324689.1 DnaJ 2..>92 CDD:223560 37/85 (44%)
DnaJ-X 135..325 CDD:405064 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.