powered by:
Protein Alignment DnaJ-H and AT2G17880
DIOPT Version :9
Sequence 1: | NP_001260431.1 |
Gene: | DnaJ-H / 34707 |
FlyBaseID: | FBgn0032474 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179378.1 |
Gene: | AT2G17880 / 816298 |
AraportID: | AT2G17880 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 29/66 - (43%) |
Similarity: | 43/66 - (65%) |
Gaps: | 5/66 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPD-----KNPDAGDKFKEISFAYEVLSDPEKRRIYD 64
:||::|::...:|.:|||..||:||:..||| ::..:.|.|.:|..||..|||||||.:||
plant 68 SLYEILEIPVGSTSQEIKSAYRRLARICHPDVARNSRDNSSADDFMKIHAAYCTLSDPEKRAVYD 132
Fly 65 R 65
|
plant 133 R 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0712 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.