DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AT2G05230

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_565321.1 Gene:AT2G05230 / 815071 AraportID:AT2G05230 Length:706 Species:Arabidopsis thaliana


Alignment Length:398 Identity:92/398 - (23%)
Similarity:137/398 - (34%) Gaps:100/398 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP--DAGDKFKEISFAYEVLSDP-EKRRIYDR 65
            ::.|.||.:.|.|...|:||.|:|:|...|||||.  .|...|..||.|:..||:. .|...|  
plant    65 IDYYAVLGLKPSAGKREVKKQYKKMAVLLHPDKNKCIGADGAFHLISEAWSFLSNEFNKSTFY-- 127

  Fly    66 YGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVV----KVELTLEEIYVGGMKKKV 126
            |..|...:..|....::|:.           .|.|...|..|.    .....|:..:......||
plant   128 YKRKKHIDSTEVQKHSTEYM-----------PGTGTGTGTAVFDRFPPSSERLDTFWTVCTSCKV 181

  Fly   127 EY-------NRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTT------CPTCD 178
            :|       |::..|..|.|      |..:.|| |.|..:|.|.:...|....:      .|..:
plant   182 QYEYLRKYVNKRLSCKNCRG------AFIAVET-GPAPVSAPFHYTPPSHAPPSHAPPSHAPPSN 239

  Fly   179 GRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQM 243
            |.|....|.....|...:.|:..                   :..:||   |.::.    .....
plant   240 GYGAHGYDAMSRMPTNSTYFLGH-------------------YPGQGH---GYDYS----TNGSY 278

  Fly   244 EHPIFQRRHANLYMRDLEINITEALCGYSHCFKH------------LDGRN-VC-LRTYPGEVLQ 294
            |...:.....:....||: .::....||.  :||            .||.| .| .::.||.::.
plant   279 EWSSYSGTTTSPGNLDLK-RVSSVSNGYP--YKHSNSVVSGGINKVKDGSNGTCSKKSTPGGLIY 340

  Fly   295 HNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAE-E 358
            .|||.|   |.....||....|   .|.||      |..|.....:|:   |.:.:.:.|.|. :
plant   341 PNQISM---SAHASANKVGRPG---KKSKV------FMEAAANGFVEN---PLRSVSVSKTANTD 390

  Fly   359 VQM-TDYK 365
            .:| .|||
plant   391 AKMDQDYK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 89/394 (23%)
DnaJ 5..64 CDD:278647 24/61 (39%)
DnaJ_C 106..329 CDD:199909 50/253 (20%)
DnaJ_zf 134..197 CDD:199908 16/68 (24%)
AT2G05230NP_565321.1 DnaJ 66..120 CDD:278647 23/53 (43%)
DUF3444 472..675 CDD:288755
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.