DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and DNAJB14

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:149 Identity:56/149 - (37%)
Similarity:75/149 - (50%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |.|:||.|..||.||::||.|||||.:||||||  |.|.|.||:|..||.|||:||||:.||   
Human   108 NYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYD--- 169

  Fly    68 LKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEE---IYVGGMKKKVEYN 129
            |.|.:|.|                  .:.:..||.|.....:.::|.|:   |:.||     .:.
Human   170 LTGNEEQA------------------CNHQNNGRFNFHRGCEADITPEDLFNIFFGG-----GFP 211

  Fly   130 RQKLCSKCNGDGGPKEAHE 148
            ...:.|..||..|..:.|:
Human   212 SGSVHSFSNGRAGYSQQHQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 56/149 (38%)
DnaJ 5..64 CDD:278647 37/60 (62%)
DnaJ_C 106..329 CDD:199909 10/46 (22%)
DnaJ_zf 134..197 CDD:199908 5/15 (33%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94
DnaJ 107..>214 CDD:223560 51/131 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241 4/12 (33%)
DUF1977 271..371 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.