DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajc5

DIOPT Version :10

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_077075.1 Gene:Dnajc5 / 79130 RGDID:620516 Length:198 Species:Rattus norvegicus


Alignment Length:91 Identity:43/91 - (47%)
Similarity:62/91 - (68%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYDRY 66
            :||.||.:..:||.::|||:|||||.::|||||||   |.||||||:.|:.:|:|..||.|||:|
  Rat    15 SLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKY 79

  Fly    67 GLKGLQEGAE-GFSDASEFF--AQWF 89
            |..||....: |..:.:.:|  :.|:
  Rat    80 GSLGLYVAEQFGEENVNTYFVLSSWW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 43/91 (47%)
Dnajc5NP_077075.1 PRK10767 17..>80 CDD:236757 35/62 (56%)

Return to query results.
Submit another query.