DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc11

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001072583.1 Gene:dnajc11 / 780038 XenbaseID:XB-GENE-942676 Length:559 Species:Xenopus tropicalis


Alignment Length:337 Identity:89/337 - (26%)
Similarity:125/337 - (37%) Gaps:111/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD------AGDKFKEISFAYEVLSDPEK 59
            :||.:.|.:|.|..:||.||:|.:||:|...:||||:.|      |...|..:..||||||||:.
 Frog    10 VDNDDYYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQS 74

  Fly    60 RRIYDRYGLKGLQ----EGAEGFSDASEFFAQWFPFDRVSSEGRGRR-----NGKVVVKVELTLE 115
            |.|||.||.|||:    |..|....|:|...:   |:|:..|...||     |.|..:.|.:...
 Frog    75 RAIYDIYGKKGLEMEGWEVVERKRTAAEIREE---FERLQREREERRLQQRTNPKGTISVGIDAT 136

  Fly   116 EIY----------VGGMKKKVEYNRQKL-------------------CSKCNGDGGPK-----EA 146
            |::          .|....::|.||..:                   .|..||:||..     ..
 Frog   137 ELFDRYDEDFEDIPGSGFPQIEINRMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINLALRR 201

  Fly   147 HESCETCG----GAGRAAAFTFMGLSPFDTTCPTC----------DGRGFTIRD----------D 187
            ..|.:..|    |||......| ||..|....|.|          ..||  ||.          |
 Frog   202 VTSAKGWGELEFGAGDLQGPLF-GLKIFRNLTPKCFFTTNCALQFSSRG--IRPGLTTMVARNLD 263

  Fly   188 KKCSPCQGSGFVEQK----------MKRD-------LVVERGAPHMLKV-----PFANEGH---- 226
            |..     .|:::.:          :.||       |..:.|.||...:     .|.:|..    
 Frog   264 KNT-----MGYIQWRWGIQSAMNTSIVRDTKNSHFTLAFQLGIPHSFMMVSYQHKFQDEEQTRLK 323

  Fly   227 -QMRGGEFGDLI 237
             .::.|.||.|:
 Frog   324 GSIKAGFFGTLV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 89/337 (26%)
DnaJ 5..64 CDD:278647 28/64 (44%)
DnaJ_C 106..329 CDD:199909 41/217 (19%)
DnaJ_zf 134..197 CDD:199908 22/91 (24%)
dnajc11NP_001072583.1 DnaJ 14..79 CDD:365959 28/64 (44%)
DUF3395 410..549 CDD:371774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.