DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Samd13

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:220 Identity:57/220 - (25%)
Similarity:85/220 - (38%) Gaps:84/220 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYD 64
            :|.|.||.|..||:..:|||.:.:||.:.||||||.    |.:|||:::.||::|||.:||:.||
  Rat     2 VNYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDYD 66

  Fly    65 RYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYN 129
            |                    ::|                      ..|.||:..|..:.:..: 
  Rat    67 R--------------------SRW----------------------SRTKEELIRGDGRDETNW- 88

  Fly   130 RQKLCSK---------------CNGD---GGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPT 176
            .:::||:               .:||   .||. .|..               .|.|.|.|..|.
  Rat    89 EEEICSRRPRRTFQTVIEDEDLFSGDYLFTGPM-THSR---------------RGSSNFFTVTPI 137

  Fly   177 CDGRGFT--IRDDKKCSPCQGSGFV 199
            .| .||:  :..:.|.||.....||
  Rat   138 ID-TGFSTFVSQESKSSPDDSEAFV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 57/220 (26%)
DnaJ 5..64 CDD:278647 29/62 (47%)
DnaJ_C 106..329 CDD:199909 24/114 (21%)
DnaJ_zf 134..197 CDD:199908 18/82 (22%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 30/64 (47%)
DnaJ 3..66 CDD:278647 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.