DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb12

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:145 Identity:54/145 - (37%)
Similarity:75/145 - (51%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |::|.|:..|:||::||.|||||.:||||||  |.|.:.||.|..||.|||:||||:.||::|..
Mouse   113 YEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDD 177

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSE-------GRGRRNGKVVVKVELTLEEIYVGGMKKKVE 127
            ..|....|.|...  |.:.|..| :|.|       |.|..:..|         .:|..| :.:..
Mouse   178 KSQAARHGHSHGD--FHRGFEAD-ISPEDLFNMFFGGGFPSSNV---------HVYSNG-RMRYT 229

  Fly   128 YNRQKLCSKCNGDGG 142
            |.:::......||||
Mouse   230 YQQRQDRRDNQGDGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 54/145 (37%)
DnaJ 5..64 CDD:278647 33/58 (57%)
DnaJ_C 106..329 CDD:199909 8/37 (22%)
DnaJ_zf 134..197 CDD:199908 4/9 (44%)
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 50/136 (37%)
DUF1977 269..369 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.