DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb8

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_064348.1 Gene:Dnajb8 / 56691 MGIID:1922801 Length:227 Species:Mus musculus


Alignment Length:206 Identity:66/206 - (32%)
Similarity:89/206 - (43%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYDR 65
            |.|:||.|...|:.|:|||.|||||..:|||||||    |..|||::|.|||||||.:||.:|||
Mouse     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    66 YGLKGLQEGAEGFSDASEFFAQWFPF--------------DRVSSE-------GRGRRNGKVVVK 109
            .|....:.|.......|..|...:||              |..|.|       ||||.:|     
Mouse    68 AGCDRWRAGGGANVPHSSPFGAGYPFRNPEDIFREFFGGLDPFSFEFWDTPFSGRGRPHG----- 127

  Fly   110 VELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTC 174
                |..::..|..:...:..........|.||...:..|..:.||:|.:      |.....::.
Mouse   128 ----LHRVFPSGFGEFPAFMEALSSFNTLGHGGGSRSTFSSASFGGSGSS------GFKSVMSST 182

  Fly   175 PTCDGRGFTIR 185
            ...:||..|.:
Mouse   183 EMVNGRKVTTK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 66/206 (32%)
DnaJ 5..64 CDD:278647 36/62 (58%)
DnaJ_C 106..329 CDD:199909 13/80 (16%)
DnaJ_zf 134..197 CDD:199908 11/52 (21%)
Dnajb8NP_064348.1 DnaJ 3..66 CDD:278647 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.