Sequence 1: | NP_001260431.1 | Gene: | DnaJ-H / 34707 | FlyBaseID: | FBgn0032474 | Length: | 440 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064348.1 | Gene: | Dnajb8 / 56691 | MGIID: | 1922801 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 66/206 - (32%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 40/206 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYDR 65
Fly 66 YGLKGLQEGAEGFSDASEFFAQWFPF--------------DRVSSE-------GRGRRNGKVVVK 109
Fly 110 VELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTC 174
Fly 175 PTCDGRGFTIR 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DnaJ-H | NP_001260431.1 | DnaJ | 1..363 | CDD:223560 | 66/206 (32%) |
DnaJ | 5..64 | CDD:278647 | 36/62 (58%) | ||
DnaJ_C | 106..329 | CDD:199909 | 13/80 (16%) | ||
DnaJ_zf | 134..197 | CDD:199908 | 11/52 (21%) | ||
Dnajb8 | NP_064348.1 | DnaJ | 3..66 | CDD:278647 | 36/62 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |