DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb5

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001342367.1 Gene:Dnajb5 / 56323 MGIID:1930018 Length:420 Species:Mus musculus


Alignment Length:406 Identity:117/406 - (28%)
Similarity:168/406 - (41%) Gaps:132/406 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.:|.:...|.::||||.|||:|.::|||||  |:|.:|||||:.||:|||||:||.:||:||.:
Mouse    78 YKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGEE 142

  Fly    70 GLQ-----EGAEGFS-------DASEFFAQWF----PFDRVSSEGRGRR---------------- 102
            ||:     .|..|.|       |....||.:|    |||...:..|..|                
Mouse   143 GLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDE 207

  Fly   103 -----------NG---------------------KVVVKVELTLEEIYVGGMKKKVEYNRQKLCS 135
                       ||                     .||.::.::|||||.|..|      |.|:  
Mouse   208 DPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTK------RMKI-- 264

  Fly   136 KCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVE 200
                                       |...|:|        |||  |:|.:.|.          
Mouse   265 ---------------------------TRRRLNP--------DGR--TVRTEDKI---------- 282

  Fly   201 QKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINIT 265
                ..:|::||.....|:.|..||.........|::.|:....|..|:|...|:....| |::.
Mouse   283 ----LHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSAL-ISLK 342

  Fly   266 EALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDND 330
            |||||.:.....:|||.:.|..  .:|::...:|.:||.|:|.....|..|||.::|||:|||. 
Mouse   343 EALCGCTVNIPTIDGRVIPLPC--NDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDR- 404

  Fly   331 FATAPQL-AMLEDLLP 345
              ..||. .:|:..||
Mouse   405 --LTPQTRQILKQHLP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 117/406 (29%)
DnaJ 5..64 CDD:278647 32/58 (55%)
DnaJ_C 106..329 CDD:199909 59/222 (27%)
DnaJ_zf 134..197 CDD:199908 9/62 (15%)
Dnajb5NP_001342367.1 DnaJ 72..415 CDD:223560 115/401 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.