DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and DNAJC11

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_060668.2 Gene:DNAJC11 / 55735 HGNCID:25570 Length:559 Species:Homo sapiens


Alignment Length:230 Identity:68/230 - (29%)
Similarity:94/230 - (40%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD------AGDKFKEISFAYEVLSDPEK 59
            :||.:.|.:|.|..:|:.||:|..||:|...:||||:.|      |...|..:..||||||||:.
Human    10 LDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQT 74

  Fly    60 RRIYDRYGLKGLQ----EGAEGFSDASEFFAQWFPFDRVSSEGRGRR-------NGKVVVKVELT 113
            |.|||.||.:||:    |..|.....:|...:   |:|:..|...||       .|.:.|.|:.|
Human    75 RAIYDIYGKRGLEMEGWEVVERRRTPAEIREE---FERLQREREERRLQQRTNPKGTISVGVDAT 136

  Fly   114 -----LEEIY---VGGMKKKVEYNRQKL-------------------CSKCNGDGGPK-----EA 146
                 .:|.|   .|....::|.|:..:                   .|..||:||..     ..
Human   137 DLFDRYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRR 201

  Fly   147 HESCETCG----GAGRAAAFTFMGLSPFDTTCPTC 177
            ..|.:..|    |||......| ||..|....|.|
Human   202 VTSAKGWGELEFGAGDLQGPLF-GLKLFRNLTPRC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 68/230 (30%)
DnaJ 5..64 CDD:278647 27/64 (42%)
DnaJ_C 106..329 CDD:199909 24/108 (22%)
DnaJ_zf 134..197 CDD:199908 16/53 (30%)
DNAJC11NP_060668.2 DnaJ 14..79 CDD:278647 27/64 (42%)
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.