DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc16l

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_021335369.1 Gene:dnajc16l / 556590 ZFINID:ZDB-GENE-130530-696 Length:789 Species:Danio rerio


Alignment Length:100 Identity:41/100 - (41%)
Similarity:58/100 - (57%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYG-- 67
            |.||.|:..|:..||||.|:|||:|:|||||  |.|.|.|.:|:.:||:||:.|:|..|||:|  
Zfish    38 YSVLGVSKHASLTEIKKMYKKLAREWHPDKNKSPGAEDMFIKITKSYEILSNEERRANYDRFGQM 102

  Fly    68 -----LKGLQEGAEGFSDASEFFAQWFPFDRVSSE 97
                 .....:|...:.|:..|...:|.|.|.|.:
Zfish   103 DENQNFARPPQGFRQYHDSFYFDESFFHFPRTSRD 137

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 41/99 (41%)
DnaJ 5..64 CDD:278647 30/58 (52%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
dnajc16lXP_021335369.1 DnaJ 36..>136 CDD:333066 40/97 (41%)