DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc17

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001017233.1 Gene:dnajc17 / 549987 XenbaseID:XB-GENE-5811332 Length:310 Species:Xenopus tropicalis


Alignment Length:136 Identity:46/136 - (33%)
Similarity:70/136 - (51%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYDR 65
            ::||.:|.|.||||.:||||.||:.|...|||||||   |.:.|.::|.|.|||:|...:..|| 
 Frog    13 MDLYGLLGVGPDATAKEIKKAYRQKALTCHPDKNPDNPRAAELFHQLSQALEVLTDGAAKAAYD- 76

  Fly    66 YGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVV-----VKVELTLEEIYVGGMKKK 125
                .|::..|..:..::...:.....::..|.|.|....||     .:|..|||:..:   :.:
 Frog    77 ----NLRKAKEAAAKRTQKLDEKRKKVKLDLEAREREAQAVVTEEDEAQVAQTLEQEII---RLR 134

  Fly   126 VEYNRQ 131
            .|.:||
 Frog   135 EEGSRQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 46/136 (34%)
DnaJ 5..64 CDD:278647 30/61 (49%)
DnaJ_C 106..329 CDD:199909 9/31 (29%)
DnaJ_zf 134..197 CDD:199908
dnajc17NP_001017233.1 DnaJ 14..76 CDD:365959 30/61 (49%)
PTZ00121 <27..159 CDD:173412 38/122 (31%)
RRM_DNAJC17 188..250 CDD:240875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.