DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-H and dnajb14

DIOPT Version :9

Sequence 1:	NP_001260431.1	Gene:	DnaJ-H / 34707	FlyBaseID:	FBgn0032474	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	NP_001016588.1	Gene:	dnajb14 / 549342	XenbaseID:	XB-GENE-952313	Length:	375	Species:	Xenopus tropicalis

Alignment Length:	115	Identity:	49/115 - (42%)
Similarity:	63/115 - (54%)	Gaps:	20/115 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |:||.|:.||.:|::||.|||||.:||||||  |.|.:.||:|..||.|||:||||:.||..|.:
Frog   108 YEVLGVSTDAGEEDLKKAYRKLALKFHPDKNHAPGATEAFKKIGNAYAVLSNPEKRKQYDLTGSE 172

  Fly    70 GLQEG---------AEGF-SDASE------FFAQWFPFDRVS--SEGRGR 101
            ...:.         ..|| :|.:.      ||...||...|.  |.||.|
Frog   173 DQMQNNHRNGGFDYHRGFEADITPEDLFNMFFGGGFPSGSVHTFSNGRAR 222

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-H	NP_001260431.1	DnaJ	1..363	CDD:223560	49/115 (43%)
		DnaJ	5..64	CDD:278647	34/58 (59%)
		DnaJ_C	106..329	CDD:199909
		DnaJ_zf	134..197	CDD:199908
dnajb14	NP_001016588.1	FliS	6..>34	CDD:382133
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	48..95
		DnaJ_bact	107..>212	CDD:274090	44/103 (43%)
		DUF1977	269..367	CDD:370429
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910