DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc4

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001007515.1 Gene:dnajc4 / 493241 XenbaseID:XB-GENE-994193 Length:233 Species:Xenopus tropicalis


Alignment Length:172 Identity:50/172 - (29%)
Similarity:74/172 - (43%) Gaps:41/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDK---NPDAGDKFKEISFAYEVLSDPEKRRIYDR--- 65
            |.:|.:...||.||||..:..::|:.|||.   ||....:|..:|.||:|||....||.||:   
 Frog    34 YQLLGIERKATSEEIKNAFFTMSKKLHPDSDPTNPLLHSQFVRLSEAYKVLSRDTSRREYDQLLD 98

  Fly    66 --------YGLK-GLQEGAEGFSDASEFFAQWFPF-----DRVSSEGRGRRNGKVVVKVEL---- 112
                    ||.: ...:|....:.|.|....|..|     |  .::.|..|||::|:...|    
 Frog    99 AAQRDRWAYGARSSYYQGPSPSAAADENAHYWSQFAARRGD--PTQRRQGRNGRLVLYCLLIMAG 161

  Fly   113 ----------TLEEIYVGGMKKKVE-----YNRQKLCSKCNG 139
                      ||.||:...|:|:.:     ||..|..::.||
 Frog   162 SLTMHYVGFKTLREIHSNFMEKQHKRILKIYNEAKERARVNG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 50/172 (29%)
DnaJ 5..64 CDD:278647 23/59 (39%)
DnaJ_C 106..329 CDD:199909 13/53 (25%)
DnaJ_zf 134..197 CDD:199908 2/6 (33%)
dnajc4NP_001007515.1 DnaJ 32..94 CDD:278647 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.