DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnaja2

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:413 Identity:160/413 - (38%)
Similarity:240/413 - (58%) Gaps:33/413 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNL---NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRI 62
            |.|:   .|||:|.|||.|::.::||.|||||||:||||||:||||||||||||||||:||||.:
 Frog     1 MSNVADTKLYDILGVAPGASENDLKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKREL 65

  Fly    63 YDRYGLKGLQEGAEGFSDASEFFAQWFP---FDRVSSEGR---GRRNGK-VVVKVELTLEEIYVG 120
            |||||.:||:||:.| |...:.|:..|.   |..:..:.|   |||.|: ::..::::||::| .
 Frog    66 YDRYGEQGLREGSGG-SGMDDIFSHIFGGGLFGFMGGQSRSRNGRRRGEDMMHPLKVSLEDLY-N 128

  Fly   121 GMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSP-----FDTTCPTCDGR 180
            |...|::.::..|||.|||.||...|.:.|..|  .||........|:|     ..:.|..|:|.
 Frog   129 GKTTKLQLSKNVLCSSCNGQGGKTGAVQKCSAC--RGRGVRVMIRQLAPGMVQQMQSVCSDCNGE 191

  Fly   181 GFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEH 245
            |..|.:..:|..|:|...|::....::.|::|..|..::.|:.|..|..|.|.||:::|:.:.||
 Frog   192 GEVINEKDRCKKCEGKKVVKEVKIIEVHVDKGMKHGQRITFSGEADQAPGVEPGDIVLVLQEKEH 256

  Fly   246 PIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFN 310
            .:|||...:|:|.. .|.:.|||||:...|||||.|.:.::..||:|::...:::|||.|||.:.
 Frog   257 EVFQRDGNDLHMTH-RIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGSVRVVRGEGMPQYR 320

  Fly   311 KATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLP--PRQPIVIPKNAEEVQMTDY--------- 364
            ...:.|||::||.|.||:|::....:|..||||||  |..| .:....|||.:.::         
 Frog   321 NPFEKGDLFIKFDVIFPENNWINPDKLTELEDLLPSRPEAP-AVSGETEEVDLQEFDNTRGSSGG 384

  Fly   365 -KPQPRQQEDEDGQSSHFEGVQC 386
             :.:......:|..|.|..||||
 Frog   385 QRREAYNDSSDDESSHHGPGVQC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 153/378 (40%)
DnaJ 5..64 CDD:278647 43/58 (74%)
DnaJ_C 106..329 CDD:199909 76/227 (33%)
DnaJ_zf 134..197 CDD:199908 22/67 (33%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 158/410 (39%)
DnaJ 9..67 CDD:278647 43/57 (75%)
DnaJ_C 113..339 CDD:199909 76/229 (33%)
DnaJ_zf 142..208 CDD:199908 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6870
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43888
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.