DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajb4

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 / 445061 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio


Alignment Length:411 Identity:100/411 - (24%)
Similarity:162/411 - (39%) Gaps:142/411 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.:|.:...|:|::|||.|||.|.::|||||  .:|.:||||::.||||||||:||.|||:||.:
Zfish     6 YKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYDQYGEE 70

  Fly    70 GLQ-----------------------------------------------------EGAEGFSDA 81
            ||:                                                     :|.:.|...
Zfish    71 GLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVDGNDPFGSF 135

  Fly    82 SEFFAQWFPFDR-VSSEGRGRRNGKVVVKVEL--TLEEIYVGGMKKKVEYNRQKLCSKCNGDGGP 143
            :.|....||.:| |...|..||.....:..||  :|||::.|..|      |.|:..|       
Zfish   136 TSFNINGFPRERHVGQGGPPRRKQDPAIHHELRVSLEEVFHGSTK------RMKISRK------- 187

  Fly   144 KEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLV 208
                                  .|:|        |||  |:|.:.|....:              
Zfish   188 ----------------------RLNP--------DGR--TLRTEDKILTIE-------------- 206

  Fly   209 VERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSH 273
            ::||.....|:.|..||.:.......|::.||....|..|:|..::: :..:.:::.::|||.|.
Zfish   207 IKRGWKEGTKITFPREGDETPNTIPADIVFVIKDKPHGHFRREGSDI-VYPVRVSLRQSLCGCSV 270

  Fly   274 CFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLA 338
            ....:||:...::.  .:|::....|::.|.|:|........|||.::|.|.||::         
Zfish   271 TVSTIDGKTCNMKI--TDVIKPGMRKVIAGQGLPFPKNPEQRGDLIVEFDVNFPES--------- 324

  Fly   339 MLEDLLPPRQPIVIPKNAEEV 359
                         :|.||::|
Zfish   325 -------------LPTNAKDV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 100/411 (24%)
DnaJ 5..64 CDD:278647 32/58 (55%)
DnaJ_C 106..329 CDD:199909 48/224 (21%)
DnaJ_zf 134..197 CDD:199908 9/62 (15%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 100/411 (24%)
DnaJ 4..65 CDD:278647 32/58 (55%)
DnaJ_C 163..325 CDD:199909 48/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.